PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_011090070.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Pedaliaceae; Sesamum
Family LBD
Protein Properties Length: 137aa    MW: 15316.4 Da    PI: 4.8178
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_011090070.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF26069.19.3e-221058149
          DUF260  1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkal 49
                    +CaaC++lrr+C+kdC ++pyfp ++p+kfa+vh++FGasn++k+l+  
  XP_011090070.1 10 PCAACRFLRRRCTKDCLFSPYFPPAEPEKFAAVHRIFGASNISKMLQVF 58
                    7*********************************************976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089115.359112IPR004883Lateral organ boundaries, LOB
PfamPF031955.0E-221081IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 137 aa     Download sequence    Send to blast
MESCSRTIMP CAACRFLRRR CTKDCLFSPY FPPAEPEKFA AVHRIFGASN ISKMLQVFGL  60
QSELDEVLAE NATLRAQLSV ALSLVASCQS FPFVENSNQE SNHQLQPSEC GNSQNSDMML  120
QYDQVTDSYT ALANMFL
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011090070.12e-98PREDICTED: LOB domain-containing protein 24-like
TrEMBLK4CAD26e-27K4CAD2_SOLLC; Uncharacterized protein
STRINGSolyc06g082770.2.12e-26(Solanum lycopersicum)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G26660.12e-25LOB domain-containing protein 24